GPX7 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: GPX7 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A3902
• Hersteller Artikelnummer: A3902
• Alternativnummer: ABB-A3902-100UL,ABB-A3902-20UL,ABB-A3902-500UL,ABB-A3902-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: GPX6, CL683, GPx-7, NPGPx, GSHPx-7, GPX7

Produktbeschreibung

Enables catalase activity. Predicted to be involved in cellular response to oxidative stress. Located in endoplasmic reticulum.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 21kDa
• NCBI: 2882
• UniProt: Q96SL4
• Reinheit: Affinity purification
• Sequenz: QQEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVTGTGAHPAFKYLAQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALVRKLILLKREDL
• Target-Kategorie: GPX7
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Endocrine Metabolism. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using GPX7 Rabbit pAb (A3902) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.