GPX7 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: GPX7 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A3902
• Supplier Catalog Number: A3902
• Alternative Catalog Number: ABB-A3902-100UL,ABB-A3902-20UL,ABB-A3902-500UL,ABB-A3902-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: GPX6, CL683, GPx-7, NPGPx, GSHPx-7, GPX7

Product Description

Enables catalase activity. Predicted to be involved in cellular response to oxidative stress. Located in endoplasmic reticulum.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 21kDa
• NCBI: 2882
• UniProt: Q96SL4
• Purity: Affinity purification
• Sequence: QQEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVTGTGAHPAFKYLAQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALVRKLILLKREDL
• Target: GPX7
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Endocrine Metabolism. Shipping: Ice Bag

Images

Western blot analysis of various lysates using GPX7 Rabbit pAb (A3902) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.