GPX7 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A3902
Article Name: GPX7 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A3902
Supplier Catalog Number: A3902
Alternative Catalog Number: ABB-A3902-100UL,ABB-A3902-20UL,ABB-A3902-500UL,ABB-A3902-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: GPX6, CL683, GPx-7, NPGPx, GSHPx-7, GPX7
Enables catalase activity. Predicted to be involved in cellular response to oxidative stress. Located in endoplasmic reticulum.
Clonality: Polyclonal
Molecular Weight: 21kDa
NCBI: 2882
UniProt: Q96SL4
Purity: Affinity purification
Sequence: QQEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVTGTGAHPAFKYLAQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALVRKLILLKREDL
Target: GPX7
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Endocrine Metabolism. Shipping: Ice Bag
Western blot analysis of various lysates using GPX7 Rabbit pAb (A3902) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.