SH3GL3 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: SH3GL3 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A4112
• Hersteller Artikelnummer: A4112
• Alternativnummer: ABB-A4112-100UL,ABB-A4112-20UL,ABB-A4112-1000UL,ABB-A4112-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: CNSA3, EEN-B2, SH3D2C, SH3P13, HsT19371, SH3GL3

Produktbeschreibung

Enables identical protein binding activity. Predicted to be involved in synaptic vesicle uncoating. Predicted to be located in acrosomal vesicle, early endosome membrane, and presynapse. Predicted to be part of early endosome. Predicted to be active in glutamatergic synapse, postsynaptic density, intracellular component, and postsynaptic endosome.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 39kDa
• NCBI: 6457
• UniProt: Q99963
• Reinheit: Affinity purification
• Sequenz: MSVAGLKKQFHKASQLFSEKISGAEGTKLDDEFLDMERKIDVTNKVVAEILSKTTEYLQPNPAYRAKLGMLNTVSKIRGQVKTTGYPQTEGLLGDCMLKYGKELGEDSTFGNALIEVGESMKLMAEVKDSLDINVKQTFIDPLQLLQDKDLKEIGHHLKKLEGRRLDYDYKKKRVGKIPDEEVRQAVEKFEESKELAERSMFNFLENDVEQVSQLAVFIEAALDYHRQSTEILQELQSKLQMRISAASSVPRREY
• Target-Kategorie: SH3GL3
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Neuroscience,Neurodegenerative Diseases. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates, using SH3GL3 Rabbit pAb (A4112) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.