SH3GL3 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: SH3GL3 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A4112
• Supplier Catalog Number: A4112
• Alternative Catalog Number: ABB-A4112-100UL,ABB-A4112-20UL,ABB-A4112-1000UL,ABB-A4112-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: CNSA3, EEN-B2, SH3D2C, SH3P13, HsT19371, SH3GL3

Product Description

Enables identical protein binding activity. Predicted to be involved in synaptic vesicle uncoating. Predicted to be located in acrosomal vesicle, early endosome membrane, and presynapse. Predicted to be part of early endosome. Predicted to be active in glutamatergic synapse, postsynaptic density, intracellular component, and postsynaptic endosome.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 39kDa
• NCBI: 6457
• UniProt: Q99963
• Purity: Affinity purification
• Sequence: MSVAGLKKQFHKASQLFSEKISGAEGTKLDDEFLDMERKIDVTNKVVAEILSKTTEYLQPNPAYRAKLGMLNTVSKIRGQVKTTGYPQTEGLLGDCMLKYGKELGEDSTFGNALIEVGESMKLMAEVKDSLDINVKQTFIDPLQLLQDKDLKEIGHHLKKLEGRRLDYDYKKKRVGKIPDEEVRQAVEKFEESKELAERSMFNFLENDVEQVSQLAVFIEAALDYHRQSTEILQELQSKLQMRISAASSVPRREY
• Target: SH3GL3
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Neuroscience,Neurodegenerative Diseases. Shipping: Ice Bag

Images

Western blot analysis of various lysates, using SH3GL3 Rabbit pAb (A4112) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.