SRP9 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: SRP9 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A4124
• Hersteller Artikelnummer: A4124
• Alternativnummer: ABB-A4124-100UL,ABB-A4124-20UL,ABB-A4124-1000UL,ABB-A4124-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: ALURBP, SRP9

Produktbeschreibung

Predicted to enable RNA binding activity and signal recognition particle binding activity. Predicted to be involved in SRP-dependent cotranslational protein targeting to membrane. Predicted to be located in cytosol. Predicted to be part of signal recognition particle, endoplasmic reticulum targeting.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 10kDa
• NCBI: 6726
• UniProt: P49458
• Reinheit: Affinity purification
• Sequenz: MPQYQTWEEFSRAAEKLYLADPMKARVVLKYRHSDGNLCVKVTDDLVCLVYKTDQAQDVKKIEKFHSQLMRLMVAKEARNVTMETE
• Target-Kategorie: SRP9
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:1000 - 1:2000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. Shipping: Ice Bag

Bilder

Western blot analysis of lysates from A-431 cells, using SRP9 Rabbit pAb (A4124) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.