SRP9 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: SRP9 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A4124
• Supplier Catalog Number: A4124
• Alternative Catalog Number: ABB-A4124-100UL,ABB-A4124-20UL,ABB-A4124-1000UL,ABB-A4124-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: ALURBP, SRP9

Product Description

Predicted to enable RNA binding activity and signal recognition particle binding activity. Predicted to be involved in SRP-dependent cotranslational protein targeting to membrane. Predicted to be located in cytosol. Predicted to be part of signal recognition particle, endoplasmic reticulum targeting.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 10kDa
• NCBI: 6726
• UniProt: P49458
• Purity: Affinity purification
• Sequence: MPQYQTWEEFSRAAEKLYLADPMKARVVLKYRHSDGNLCVKVTDDLVCLVYKTDQAQDVKKIEKFHSQLMRLMVAKEARNVTMETE
• Target: SRP9
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:1000 - 1:2000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse. Shipping: Ice Bag

Images

Western blot analysis of lysates from A-431 cells, using SRP9 Rabbit pAb (A4124) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.