TEAD4 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: TEAD4 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A4151
• Hersteller Artikelnummer: A4151
• Alternativnummer: ABB-A4151-100UL,ABB-A4151-20UL,ABB-A4151-500UL,ABB-A4151-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: TEF3, RTEF1, TEF-3, EFTR-2, TEFR-1, TCF13L1, hRTEF-1B, TEAD4

Produktbeschreibung

This gene product is a member of the transcriptional enhancer factor (TEF) family of transcription factors, which contain the TEA/ATTS DNA-binding domain. It is preferentially expressed in the skeletal muscle, and binds to the M-CAT regulatory element found in promoters of muscle-specific genes to direct their gene expression. Alternatively spliced transcripts encoding distinct isoforms, some of which are translated through the use of a non-AUG (UUG) initiation codon, have been described for this gene.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 48kDa
• NCBI: 7004
• UniProt: Q15561
• Reinheit: Affinity purification
• Sequenz: AREIQAKLKDQAAKDKALQSMAAMSSAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHI
• Target-Kategorie: TEAD4
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cell Biology Developmental Biology,Cardiovascular,Heart,Cardiogenesis. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using TEAD4 Rabbit pAb (A4151) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.