TEAD4 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: TEAD4 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A4151
• Supplier Catalog Number: A4151
• Alternative Catalog Number: ABB-A4151-100UL,ABB-A4151-20UL,ABB-A4151-500UL,ABB-A4151-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: TEF3, RTEF1, TEF-3, EFTR-2, TEFR-1, TCF13L1, hRTEF-1B, TEAD4

Product Description

This gene product is a member of the transcriptional enhancer factor (TEF) family of transcription factors, which contain the TEA/ATTS DNA-binding domain. It is preferentially expressed in the skeletal muscle, and binds to the M-CAT regulatory element found in promoters of muscle-specific genes to direct their gene expression. Alternatively spliced transcripts encoding distinct isoforms, some of which are translated through the use of a non-AUG (UUG) initiation codon, have been described for this gene.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 48kDa
• NCBI: 7004
• UniProt: Q15561
• Purity: Affinity purification
• Sequence: AREIQAKLKDQAAKDKALQSMAAMSSAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHI
• Target: TEAD4
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cell Biology Developmental Biology,Cardiovascular,Heart,Cardiogenesis. Shipping: Ice Bag

Images

Western blot analysis of various lysates using TEAD4 Rabbit pAb (A4151) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.