FZD7 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: FZD7 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A4213
• Hersteller Artikelnummer: A4213
• Alternativnummer: ABB-A4213-100UL,ABB-A4213-20UL,ABB-A4213-500UL,ABB-A4213-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: FzE3, FZD7

Produktbeschreibung

Members of the frizzled gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD7 protein contains an N-terminal signal sequence, 10 cysteine residues typical of the cysteine-rich extracellular domain of Fz family members, 7 putative transmembrane domains, and an intracellular C-terminal tail with a PDZ domain-binding motif. FZD7 gene expression may downregulate APC function and enhance beta-catenin-mediated signals in poorly differentiated human esophageal carcinomas.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 64kDa
• NCBI: 8324
• UniProt: O75084
• Reinheit: Affinity purification
• Sequenz: MRDPGAAAPLSSLGLCALVLALLGALSAGAGAQPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYLPDLPFTALPPGASDGRGRPAFPFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRANGLMYFKEEERRFARL
• Target-Kategorie: FZD7
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Translation Control,Regulation of eIF4 and p70 S6 Kinase,Cancer,Signal Transduction,G protein signaling,G-Protein-Coupled ReceptorsGPCR,mTOR Signaling Pathway,Cell Biology Developmental Biology,Wnt -Catenin Signaling Pathway,ESC Pluripotency and Differentiation,Stem Cells. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using FZD7 Rabbit pAb (A4213) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.