FZD7 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: FZD7 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A4213
• Supplier Catalog Number: A4213
• Alternative Catalog Number: ABB-A4213-100UL,ABB-A4213-20UL,ABB-A4213-500UL,ABB-A4213-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: FzE3, FZD7

Product Description

Members of the frizzled gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD7 protein contains an N-terminal signal sequence, 10 cysteine residues typical of the cysteine-rich extracellular domain of Fz family members, 7 putative transmembrane domains, and an intracellular C-terminal tail with a PDZ domain-binding motif. FZD7 gene expression may downregulate APC function and enhance beta-catenin-mediated signals in poorly differentiated human esophageal carcinomas.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 64kDa
• NCBI: 8324
• UniProt: O75084
• Purity: Affinity purification
• Sequence: MRDPGAAAPLSSLGLCALVLALLGALSAGAGAQPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYLPDLPFTALPPGASDGRGRPAFPFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRANGLMYFKEEERRFARL
• Target: FZD7
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Translation Control,Regulation of eIF4 and p70 S6 Kinase,Cancer,Signal Transduction,G protein signaling,G-Protein-Coupled ReceptorsGPCR,mTOR Signaling Pathway,Cell Biology Developmental Biology,Wnt -Catenin Signaling Pathway,ESC Pluripotency and Differentiation,Stem Cells. Shipping: Ice Bag

Images

Western blot analysis of various lysates using FZD7 Rabbit pAb (A4213) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.