GOSR2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A4321
- Bilder (1)
| Artikelname: | GOSR2 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A4321 |
| Hersteller Artikelnummer: | A4321 |
| Alternativnummer: | ABB-A4321-20UL,ABB-A4321-100UL,ABB-A4321-500UL,ABB-A4321-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | Bos1, EPM6, GS27, MYOS, GOSR2 |
| This gene encodes a trafficking membrane protein which transports proteins among the medial- and trans-Golgi compartments. Due to its chromosomal location and trafficking function, this gene may be involved in familial essential hypertension. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 25kDa |
| NCBI: | 9570 |
| UniProt: | O14653 |
| Reinheit: | Affinity purification |
| Sequenz: | MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDLILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDK |
| Target-Kategorie: | GOSR2 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human. ResearchArea: Signal Transduction. Shipping: Ice Bag |

