GOSR2 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: GOSR2 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A4321
• Supplier Catalog Number: A4321
• Alternative Catalog Number: ABB-A4321-20UL,ABB-A4321-100UL,ABB-A4321-500UL,ABB-A4321-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: Bos1, EPM6, GS27, MYOS, GOSR2

Product Description

This gene encodes a trafficking membrane protein which transports proteins among the medial- and trans-Golgi compartments. Due to its chromosomal location and trafficking function, this gene may be involved in familial essential hypertension.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 25kDa
• NCBI: 9570
• UniProt: O14653
• Purity: Affinity purification
• Sequence: MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDLILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDK
• Target: GOSR2
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human. ResearchArea: Signal Transduction. Shipping: Ice Bag

Images

Western blot analysis of various lysates using GOSR2 Rabbit pAb (A4321) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.