SAFB2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A4330
Artikelname: SAFB2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A4330
Hersteller Artikelnummer: A4330
Alternativnummer: ABB-A4330-20UL,ABB-A4330-100UL,ABB-A4330-500UL,ABB-A4330-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: SAFB2
The protein encoded by this gene, along with its paralog (scaffold attachment factor B1), is a repressor of estrogen receptor alpha. The encoded protein binds scaffold/matrix attachment region (S/MAR) DNA and is involved in cell cycle regulation, apoptosis, differentiation, the stress response, and regulation of immune genes.
Klonalität: Polyclonal
Molekulargewicht: 107kDa
NCBI: 9667
UniProt: Q14151
Reinheit: Affinity purification
Sequenz: MAETLPGSGDSGPGTASLGPGVAETGTRRLSELRVIDLRAELKKRNLDTGGNKSVLMERLKKAVKEEGQDPDEIGIELEATSKKSAKRCVKGLKMEEEGTEDNGLEDDSRDGQEDMEASLENLQNMGMMDMSVLDETEVANSSAPDFGEDGTDGLLDSFCDSKEYVAAQLRQLPAQPPEHAVDGEGFKNTLETSSLNFKVTPDIEESLLEPENEKILDILGETCKSEPVKEESSELEQPFAQDTSSVGPDRKLAE
Target-Kategorie: SAFB2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Nuclear Receptor Signaling,Nuclear hormone receptors,Signal Transduction. Shipping: Ice Bag
Western blot analysis of various lysates using SAFB2 Rabbit pAb (A4330) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.