SAFB2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A4330
- Bilder (1)
| Artikelname: | SAFB2 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A4330 |
| Hersteller Artikelnummer: | A4330 |
| Alternativnummer: | ABB-A4330-20UL,ABB-A4330-100UL,ABB-A4330-500UL,ABB-A4330-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | SAFB2 |
| The protein encoded by this gene, along with its paralog (scaffold attachment factor B1), is a repressor of estrogen receptor alpha. The encoded protein binds scaffold/matrix attachment region (S/MAR) DNA and is involved in cell cycle regulation, apoptosis, differentiation, the stress response, and regulation of immune genes. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 107kDa |
| NCBI: | 9667 |
| UniProt: | Q14151 |
| Reinheit: | Affinity purification |
| Sequenz: | MAETLPGSGDSGPGTASLGPGVAETGTRRLSELRVIDLRAELKKRNLDTGGNKSVLMERLKKAVKEEGQDPDEIGIELEATSKKSAKRCVKGLKMEEEGTEDNGLEDDSRDGQEDMEASLENLQNMGMMDMSVLDETEVANSSAPDFGEDGTDGLLDSFCDSKEYVAAQLRQLPAQPPEHAVDGEGFKNTLETSSLNFKVTPDIEESLLEPENEKILDILGETCKSEPVKEESSELEQPFAQDTSSVGPDRKLAE |
| Target-Kategorie: | SAFB2 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:1000 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Nuclear Receptor Signaling,Nuclear hormone receptors,Signal Transduction. Shipping: Ice Bag |

