SAFB2 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: SAFB2 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A4330
• Supplier Catalog Number: A4330
• Alternative Catalog Number: ABB-A4330-20UL,ABB-A4330-100UL,ABB-A4330-500UL,ABB-A4330-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: SAFB2

Product Description

The protein encoded by this gene, along with its paralog (scaffold attachment factor B1), is a repressor of estrogen receptor alpha. The encoded protein binds scaffold/matrix attachment region (S/MAR) DNA and is involved in cell cycle regulation, apoptosis, differentiation, the stress response, and regulation of immune genes.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 107kDa
• NCBI: 9667
• UniProt: Q14151
• Purity: Affinity purification
• Sequence: MAETLPGSGDSGPGTASLGPGVAETGTRRLSELRVIDLRAELKKRNLDTGGNKSVLMERLKKAVKEEGQDPDEIGIELEATSKKSAKRCVKGLKMEEEGTEDNGLEDDSRDGQEDMEASLENLQNMGMMDMSVLDETEVANSSAPDFGEDGTDGLLDSFCDSKEYVAAQLRQLPAQPPEHAVDGEGFKNTLETSSLNFKVTPDIEESLLEPENEKILDILGETCKSEPVKEESSELEQPFAQDTSSVGPDRKLAE
• Target: SAFB2
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:1000 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Nuclear Receptor Signaling,Nuclear hormone receptors,Signal Transduction. Shipping: Ice Bag

Images

Western blot analysis of various lysates using SAFB2 Rabbit pAb (A4330) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.