USH1C Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: USH1C Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A4368
• Hersteller Artikelnummer: A4368
• Alternativnummer: ABB-A4368-100UL,ABB-A4368-20UL,ABB-A4368-500UL,ABB-A4368-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Zebrafish
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: zgc:136806, USH1C

Produktbeschreibung

Predicted to enable actin filament binding activity. Acts upstream of or within neuron development, startle response, and synapse organization. Predicted to be part of stereocilia ankle link complex. Predicted to be active in several cellular components, including cilium, photoreceptor inner segment, and stereocilium tip. Is expressed in brain, hair cell, pleuroperitoneal region, sensory system, and trunk musculature. Used to study Usher syndrome. Human ortholog(s) of this gene implicated in Usher syndrome, Usher syndrome type 1, Usher syndrome type 1C, and autosomal recessive nonsyndromic deafness 18A. Orthologous to human USH1C (USH1 protein network component harmonin).

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 45kDa/58kDa/60kDa/62kDa/101kDa
• NCBI: 564412
• Reinheit: Affinity purification
• Sequenz: MERKVAREFRHKVELLIDNEAEKDYLYDVLRMYHQSMDLPVLVGDLKLVINEPKRLPLFDAIRPLIPLKHQVQYDQLTPKRSRKLKEVRLDRTHPEGLGL
• Target-Kategorie: ush1c
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology & Developmental Biology,Apoptosis,Neuroscience. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using USH1C Rabbit pAb (A4368) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.