USH1C Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: USH1C Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A4368
• Supplier Catalog Number: A4368
• Alternative Catalog Number: ABB-A4368-100UL,ABB-A4368-20UL,ABB-A4368-500UL,ABB-A4368-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Zebrafish
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: zgc:136806, USH1C

Product Description

Predicted to enable actin filament binding activity. Acts upstream of or within neuron development, startle response, and synapse organization. Predicted to be part of stereocilia ankle link complex. Predicted to be active in several cellular components, including cilium, photoreceptor inner segment, and stereocilium tip. Is expressed in brain, hair cell, pleuroperitoneal region, sensory system, and trunk musculature. Used to study Usher syndrome. Human ortholog(s) of this gene implicated in Usher syndrome, Usher syndrome type 1, Usher syndrome type 1C, and autosomal recessive nonsyndromic deafness 18A. Orthologous to human USH1C (USH1 protein network component harmonin).

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 45kDa/58kDa/60kDa/62kDa/101kDa
• NCBI: 564412
• Purity: Affinity purification
• Sequence: MERKVAREFRHKVELLIDNEAEKDYLYDVLRMYHQSMDLPVLVGDLKLVINEPKRLPLFDAIRPLIPLKHQVQYDQLTPKRSRKLKEVRLDRTHPEGLGL
• Target: ush1c
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology & Developmental Biology,Apoptosis,Neuroscience. Shipping: Ice Bag

Images

Western blot analysis of various lysates using USH1C Rabbit pAb (A4368) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.