PQBP1 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: PQBP1 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A4369
• Hersteller Artikelnummer: A4369
• Alternativnummer: ABB-A4369-20UL,ABB-A4369-100UL,ABB-A4369-500UL,ABB-A4369-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: SHS, MRX2, MRX55, MRXS3, MRXS8, NPW38, RENS1, PQBP1

Produktbeschreibung

This gene encodes a nuclear polyglutamine-binding protein that is involved with transcription activation. The encoded protein contains a WW domain. Mutations in this gene have been found in patients with Renpenning syndrome 1 and other syndromes with X-linked cognitive disability. Multiple alternatively spliced transcript variants that encode different protein isoforms have been described for this gene.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 30kDa
• NCBI: 10084
• UniProt: O60828
• Reinheit: Affinity purification
• Sequenz: MPLPVALQTRLAKRGILKHLEPEPEEEIIAEDYDDDPVDYEATRLEGLPPSWYKVFDPSCGLPYYWNADTDLVSWLSPHDPNSVVTKSAKKLRSSNADAEEKLDRSHDKSDRGHDKSDRSHEKLDRGHDKSDRGHDKSDRDRERGYDKVDRERERDRERDRDRGYDKADREEGKERRHHRREELAPYPKSKKAVSRKDEELDPMDPSSYSDAPRGTWSTGLPKRNEAKTGADTTAAGPLFQQRPYPSPGAVLRAN
• Target-Kategorie: PQBP1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cancer,Signal Transduction,Endocrine Metabolism,Lipid Metabolism,Neuroscience,Neurodegenerative Diseases. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using PQBP1 Rabbit pAb (A4369) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.