PQBP1 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: PQBP1 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A4369
• Supplier Catalog Number: A4369
• Alternative Catalog Number: ABB-A4369-20UL,ABB-A4369-100UL,ABB-A4369-500UL,ABB-A4369-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: SHS, MRX2, MRX55, MRXS3, MRXS8, NPW38, RENS1, PQBP1

Product Description

This gene encodes a nuclear polyglutamine-binding protein that is involved with transcription activation. The encoded protein contains a WW domain. Mutations in this gene have been found in patients with Renpenning syndrome 1 and other syndromes with X-linked cognitive disability. Multiple alternatively spliced transcript variants that encode different protein isoforms have been described for this gene.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 30kDa
• NCBI: 10084
• UniProt: O60828
• Purity: Affinity purification
• Sequence: MPLPVALQTRLAKRGILKHLEPEPEEEIIAEDYDDDPVDYEATRLEGLPPSWYKVFDPSCGLPYYWNADTDLVSWLSPHDPNSVVTKSAKKLRSSNADAEEKLDRSHDKSDRGHDKSDRSHEKLDRGHDKSDRGHDKSDRDRERGYDKVDRERERDRERDRDRGYDKADREEGKERRHHRREELAPYPKSKKAVSRKDEELDPMDPSSYSDAPRGTWSTGLPKRNEAKTGADTTAAGPLFQQRPYPSPGAVLRAN
• Target: PQBP1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cancer,Signal Transduction,Endocrine Metabolism,Lipid Metabolism,Neuroscience,Neurodegenerative Diseases. Shipping: Ice Bag

Images

Western blot analysis of various lysates using PQBP1 Rabbit pAb (A4369) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.