SF3A1 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: SF3A1 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A4399
• Hersteller Artikelnummer: A4399
• Alternativnummer: ABB-A4399-20UL,ABB-A4399-100UL,ABB-A4399-1000UL,ABB-A4399-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: PRP21, PRPF21, SAP114, SF3A120, SF3A1

Produktbeschreibung

This gene encodes a subunit of the splicing factor 3a protein complex. The splicing factor 3a heterotrimer is a component of the mature U2 small nuclear ribonucleoprotein particle (snRNP). U2 small nuclear ribonucleoproteins play a critical role in spliceosome assembly and pre-mRNA splicing.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 89kDa
• NCBI: 10291
• UniProt: Q15459
• Reinheit: Affinity purification
• Sequenz: QDKTEWKLNGQVLVFTLPLTDQVSVIKVKIHEATGMPAGKQKLQYEGIFIKDSNSLAYYNMANGAVIHLAL
• Target-Kategorie: SF3A1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:1000 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using SF3A1 Rabbit pAb (A4399) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.