SF3A1 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: SF3A1 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A4399
• Supplier Catalog Number: A4399
• Alternative Catalog Number: ABB-A4399-20UL,ABB-A4399-100UL,ABB-A4399-1000UL,ABB-A4399-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: PRP21, PRPF21, SAP114, SF3A120, SF3A1

Product Description

This gene encodes a subunit of the splicing factor 3a protein complex. The splicing factor 3a heterotrimer is a component of the mature U2 small nuclear ribonucleoprotein particle (snRNP). U2 small nuclear ribonucleoproteins play a critical role in spliceosome assembly and pre-mRNA splicing.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 89kDa
• NCBI: 10291
• UniProt: Q15459
• Purity: Affinity purification
• Sequence: QDKTEWKLNGQVLVFTLPLTDQVSVIKVKIHEATGMPAGKQKLQYEGIFIKDSNSLAYYNMANGAVIHLAL
• Target: SF3A1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:1000 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding. Shipping: Ice Bag

Images

Western blot analysis of various lysates using SF3A1 Rabbit pAb (A4399) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.