TUBGCP3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A4417
- Bilder (1)
| Artikelname: | TUBGCP3 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A4417 |
| Hersteller Artikelnummer: | A4417 |
| Alternativnummer: | ABB-A4417-20UL,ABB-A4417-100UL,ABB-A4417-1000UL,ABB-A4417-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | 104p, ALP6, GCP3, Spc98, SPBC98, Spc98p, Grip104, TUBGCP3 |
| Enables gamma-tubulin binding activity. Predicted to be involved in meiotic cell cycle, microtubule cytoskeleton organization, and mitotic cell cycle. Located in cytoplasm and microtubule cytoskeleton. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 104kDa |
| NCBI: | 10426 |
| UniProt: | Q96CW5 |
| Reinheit: | Affinity purification |
| Sequenz: | MATPDQKSPNVLLQNLCCRILGRSEADVAQQFQYAVRVIGSNFAPTVERDEFLVAEKIKKELIRQRREADAALFSELHRKLHSQGVLKNKWSILYLLLSLSEDPRRQPSKVSSYATLFAQALPRDAHSTPYYYARPQTLPLSYQDRSAQSAQSSGSVGSSGISSIGLCALSGPAPAPQSLLPGQSNQAPGVGDCLRQQLGSRLAWTLTANQPSSQATTSKGVPSAVSRNMTRSRREGDTGGTMEITEAAL |
| Target-Kategorie: | TUBGCP3 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cell Cycle,Centrosome,Cytoskeleton,Microtubules,Immunology Inflammation,CDs. Shipping: Ice Bag |

