TUBGCP3 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: TUBGCP3 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A4417
• Hersteller Artikelnummer: A4417
• Alternativnummer: ABB-A4417-20UL,ABB-A4417-100UL,ABB-A4417-1000UL,ABB-A4417-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: 104p, ALP6, GCP3, Spc98, SPBC98, Spc98p, Grip104, TUBGCP3

Produktbeschreibung

Enables gamma-tubulin binding activity. Predicted to be involved in meiotic cell cycle, microtubule cytoskeleton organization, and mitotic cell cycle. Located in cytoplasm and microtubule cytoskeleton.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 104kDa
• NCBI: 10426
• UniProt: Q96CW5
• Reinheit: Affinity purification
• Sequenz: MATPDQKSPNVLLQNLCCRILGRSEADVAQQFQYAVRVIGSNFAPTVERDEFLVAEKIKKELIRQRREADAALFSELHRKLHSQGVLKNKWSILYLLLSLSEDPRRQPSKVSSYATLFAQALPRDAHSTPYYYARPQTLPLSYQDRSAQSAQSSGSVGSSGISSIGLCALSGPAPAPQSLLPGQSNQAPGVGDCLRQQLGSRLAWTLTANQPSSQATTSKGVPSAVSRNMTRSRREGDTGGTMEITEAAL
• Target-Kategorie: TUBGCP3
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cell Cycle,Centrosome,Cytoskeleton,Microtubules,Immunology Inflammation,CDs. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using TUBGCP3 Rabbit pAb (A4417) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.