TUBGCP3 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: TUBGCP3 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A4417
• Supplier Catalog Number: A4417
• Alternative Catalog Number: ABB-A4417-20UL,ABB-A4417-100UL,ABB-A4417-1000UL,ABB-A4417-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: 104p, ALP6, GCP3, Spc98, SPBC98, Spc98p, Grip104, TUBGCP3

Product Description

Enables gamma-tubulin binding activity. Predicted to be involved in meiotic cell cycle, microtubule cytoskeleton organization, and mitotic cell cycle. Located in cytoplasm and microtubule cytoskeleton.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 104kDa
• NCBI: 10426
• UniProt: Q96CW5
• Purity: Affinity purification
• Sequence: MATPDQKSPNVLLQNLCCRILGRSEADVAQQFQYAVRVIGSNFAPTVERDEFLVAEKIKKELIRQRREADAALFSELHRKLHSQGVLKNKWSILYLLLSLSEDPRRQPSKVSSYATLFAQALPRDAHSTPYYYARPQTLPLSYQDRSAQSAQSSGSVGSSGISSIGLCALSGPAPAPQSLLPGQSNQAPGVGDCLRQQLGSRLAWTLTANQPSSQATTSKGVPSAVSRNMTRSRREGDTGGTMEITEAAL
• Target: TUBGCP3
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cell Cycle,Centrosome,Cytoskeleton,Microtubules,Immunology Inflammation,CDs. Shipping: Ice Bag

Images

Western blot analysis of various lysates using TUBGCP3 Rabbit pAb (A4417) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.