PNMA2 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: PNMA2 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A4448
• Hersteller Artikelnummer: A4448
• Alternativnummer: ABB-A4448-100UL,ABB-A4448-20UL,ABB-A4448-500UL,ABB-A4448-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: MA2, MM2, RGAG2, PNMA2

Produktbeschreibung

Predicted to be involved in positive regulation of apoptotic process. Predicted to be located in nucleolus.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 42kDa
• NCBI: 10687
• UniProt: Q9UL42
• Reinheit: Affinity purification
• Sequenz: MALALLEDWCRIMSVDEQKSLMVTGIPADFEEAEIQEVLQETLKSLGRYRLLGKIFRKQENANAVLLELLEDTDVSAIPSEVQGKGGVWKVIFKTPNQDTEFLERLNLFLEKEGQTVSGMFRALGQEGVSPATVPCISPE
• Target-Kategorie: PNMA2
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Rat. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using PNMA2 Rabbit pAb (A4448) at 1:3000 dilution._Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25µg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 90s.