PNMA2 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: PNMA2 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A4448
• Supplier Catalog Number: A4448
• Alternative Catalog Number: ABB-A4448-100UL,ABB-A4448-20UL,ABB-A4448-500UL,ABB-A4448-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: MA2, MM2, RGAG2, PNMA2

Product Description

Predicted to be involved in positive regulation of apoptotic process. Predicted to be located in nucleolus.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 42kDa
• NCBI: 10687
• UniProt: Q9UL42
• Purity: Affinity purification
• Sequence: MALALLEDWCRIMSVDEQKSLMVTGIPADFEEAEIQEVLQETLKSLGRYRLLGKIFRKQENANAVLLELLEDTDVSAIPSEVQGKGGVWKVIFKTPNQDTEFLERLNLFLEKEGQTVSGMFRALGQEGVSPATVPCISPE
• Target: PNMA2
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Rat. Shipping: Ice Bag

Images

Western blot analysis of various lysates using PNMA2 Rabbit pAb (A4448) at 1:3000 dilution._Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25µg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 90s.