LARP1 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: LARP1 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A4543
• Hersteller Artikelnummer: A4543
• Alternativnummer: ABB-A4543-100UL,ABB-A4543-20UL,ABB-A4543-1000UL,ABB-A4543-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: LARP, Lar1, Lhp1, LARP1

Produktbeschreibung

Enables eukaryotic initiation factor 4E binding activity, nucleic acid binding activity, and ribosomal small subunit binding activity. Involved in several processes, including TORC1 signaling, cellular response to rapamycin, and posttranscriptional regulation of gene expression. Located in cytoplasmic stress granule. Colocalizes with TORC1 complex and polysomal ribosome.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 124kDa
• NCBI: 23367
• UniProt: Q6PKG0
• Reinheit: Affinity purification
• Sequenz: AGAAGAGRRDFVEAPPPKVNPWTKNALPPVLTTVNGQSPPEHSAPAKVVRAAVPKQRKGSKVGDFGDAINWPTPGEIAHKSVQPQSHKPQPTRKLPPKKD
• Target-Kategorie: LARP1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using LARP1 Rabbit pAb (A4543) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.