LARP1 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: LARP1 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A4543
• Supplier Catalog Number: A4543
• Alternative Catalog Number: ABB-A4543-100UL,ABB-A4543-20UL,ABB-A4543-1000UL,ABB-A4543-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: LARP, Lar1, Lhp1, LARP1

Product Description

Enables eukaryotic initiation factor 4E binding activity, nucleic acid binding activity, and ribosomal small subunit binding activity. Involved in several processes, including TORC1 signaling, cellular response to rapamycin, and posttranscriptional regulation of gene expression. Located in cytoplasmic stress granule. Colocalizes with TORC1 complex and polysomal ribosome.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 124kDa
• NCBI: 23367
• UniProt: Q6PKG0
• Purity: Affinity purification
• Sequence: AGAAGAGRRDFVEAPPPKVNPWTKNALPPVLTTVNGQSPPEHSAPAKVVRAAVPKQRKGSKVGDFGDAINWPTPGEIAHKSVQPQSHKPQPTRKLPPKKD
• Target: LARP1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding. Shipping: Ice Bag

Images

Western blot analysis of various lysates using LARP1 Rabbit pAb (A4543) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.