BLOC1S6 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A4620
- Bilder (1)
| Artikelname: | BLOC1S6 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A4620 |
| Hersteller Artikelnummer: | A4620 |
| Alternativnummer: | ABB-A4620-20UL,ABB-A4620-100UL,ABB-A4620-500UL,ABB-A4620-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | PA, HPS9, PLDN, BLOS6, PALLID, BLOC1S6 |
| The protein encoded by this gene may play a role in intracellular vesicle trafficking. It interacts with Syntaxin 13 which mediates intracellular membrane fusion. Mutations in this gene cause symptoms associated with Hermansky-Pudlak syndrome-9. Alternative splicing results in multiple transcript variants. A pseudogene related to this gene is located on the X chromosome. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 20kDa |
| NCBI: | 26258 |
| UniProt: | Q9UL45 |
| Reinheit: | Affinity purification |
| Sequenz: | MSVPGPSSPDGALTRPPYCLEAGEPTPGLSDTSPDEGLIEDLTIEDKAVEQLAEGLLSHYLPDLQRSKQALQELTQNQVVLLDTLEQEISKFKECHSMLDINALFAEAKHYHAKLVNIRKEMLMLHEKTSKLKKRALKLQQKRQKEELEREQQREKEFEREKQLTARPAK |
| Target-Kategorie: | BLOC1S6 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction. Shipping: Ice Bag |

