BLOC1S6 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: BLOC1S6 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A4620
• Supplier Catalog Number: A4620
• Alternative Catalog Number: ABB-A4620-20UL,ABB-A4620-100UL,ABB-A4620-500UL,ABB-A4620-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: PA, HPS9, PLDN, BLOS6, PALLID, BLOC1S6

Product Description

The protein encoded by this gene may play a role in intracellular vesicle trafficking. It interacts with Syntaxin 13 which mediates intracellular membrane fusion. Mutations in this gene cause symptoms associated with Hermansky-Pudlak syndrome-9. Alternative splicing results in multiple transcript variants. A pseudogene related to this gene is located on the X chromosome.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 20kDa
• NCBI: 26258
• UniProt: Q9UL45
• Purity: Affinity purification
• Sequence: MSVPGPSSPDGALTRPPYCLEAGEPTPGLSDTSPDEGLIEDLTIEDKAVEQLAEGLLSHYLPDLQRSKQALQELTQNQVVLLDTLEQEISKFKECHSMLDINALFAEAKHYHAKLVNIRKEMLMLHEKTSKLKKRALKLQQKRQKEELEREQQREKEFEREKQLTARPAK
• Target: BLOC1S6
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction. Shipping: Ice Bag

Images

Western blot analysis of various lysates using BLOC1S6 Rabbit pAb (A4620) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.