IFT81 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: IFT81 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A4662
• Hersteller Artikelnummer: A4662
• Alternativnummer: ABB-A4662-20UL,ABB-A4662-100UL,ABB-A4662-500UL,ABB-A4662-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: DV1, CDV1, CDV-1, CDV1R, CDV-1R, SRTD19, IFT81

Produktbeschreibung

The protein encoded by this gene, together with IFT74, forms a tubulin-binding module of intraflagellar transport complex B. This module is involved in transport of tubulin within the cilium, and the encoded protein is required for ciliogenesis. Mutations in this gene are a cause of short-rib polydactyly syndromes.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 80kDa
• NCBI: 28981
• UniProt: Q8WYA0
• Reinheit: Affinity purification
• Sequenz: VRRLREECLQEESRYHYTNCMIKNLEVQLRRATDEMKAYISSDQQEKRKAIREQYTKNTAEQENLGKKLREKQKVIRESHGPNMKQAKMWRDLEQLMECKKQCFLKQQSQTSIGQVIQEGGEDRLIL
• Target-Kategorie: IFT81
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using IFT81 Rabbit pAb (A4662) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.