IFT81 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: IFT81 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A4662
• Supplier Catalog Number: A4662
• Alternative Catalog Number: ABB-A4662-20UL,ABB-A4662-100UL,ABB-A4662-500UL,ABB-A4662-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: DV1, CDV1, CDV-1, CDV1R, CDV-1R, SRTD19, IFT81

Product Description

The protein encoded by this gene, together with IFT74, forms a tubulin-binding module of intraflagellar transport complex B. This module is involved in transport of tubulin within the cilium, and the encoded protein is required for ciliogenesis. Mutations in this gene are a cause of short-rib polydactyly syndromes.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 80kDa
• NCBI: 28981
• UniProt: Q8WYA0
• Purity: Affinity purification
• Sequence: VRRLREECLQEESRYHYTNCMIKNLEVQLRRATDEMKAYISSDQQEKRKAIREQYTKNTAEQENLGKKLREKQKVIRESHGPNMKQAKMWRDLEQLMECKKQCFLKQQSQTSIGQVIQEGGEDRLIL
• Target: IFT81
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction. Shipping: Ice Bag

Images

Western blot analysis of various lysates using IFT81 Rabbit pAb (A4662) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.