UQCR10 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: UQCR10 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A4674
• Hersteller Artikelnummer: A4674
• Alternativnummer: ABB-A4674-100UL,ABB-A4674-20UL,ABB-A4674-1000UL,ABB-A4674-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: QCR9, UCRC, HSPC051, HSPC119, HSPC151, UCCR7.2, UQCR10

Produktbeschreibung

UCRC is a subunit of mitochondrial complex III (ubiquinol-cytochrome c reductase, EC 1.10.2.2), which forms the middle segment of the respiratory chain of the inner mitochondrial membrane (Schagger et al., 1995 [PubMed 8592474]).

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 7kDa
• NCBI: 29796
• UniProt: Q9UDW1
• Reinheit: Affinity purification
• Sequenz: MAAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK
• Target-Kategorie: UQCR10
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers,Neuroscience,Neurodegenerative Diseases. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using UQCR10 Rabbit pAb (A4674) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.