UQCR10 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: UQCR10 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A4674
• Supplier Catalog Number: A4674
• Alternative Catalog Number: ABB-A4674-100UL,ABB-A4674-20UL,ABB-A4674-1000UL,ABB-A4674-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: QCR9, UCRC, HSPC051, HSPC119, HSPC151, UCCR7.2, UQCR10

Product Description

UCRC is a subunit of mitochondrial complex III (ubiquinol-cytochrome c reductase, EC 1.10.2.2), which forms the middle segment of the respiratory chain of the inner mitochondrial membrane (Schagger et al., 1995 [PubMed 8592474]).

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 7kDa
• NCBI: 29796
• UniProt: Q9UDW1
• Purity: Affinity purification
• Sequence: MAAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK
• Target: UQCR10
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers,Neuroscience,Neurodegenerative Diseases. Shipping: Ice Bag

Images

Western blot analysis of various lysates using UQCR10 Rabbit pAb (A4674) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.