NIP7 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A4734
- Bilder (1)
| Artikelname: | NIP7 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A4734 |
| Hersteller Artikelnummer: | A4734 |
| Alternativnummer: | ABB-A4734-100UL,ABB-A4734-20UL,ABB-A4734-1000UL,ABB-A4734-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | KD93, CGI-37, HSPC031, NIP7 |
| Enables RNA binding activity. Predicted to be involved in ribosomal large subunit biogenesis. Located in cytosol, nucleolus, and nucleoplasm. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 20kDa |
| NCBI: | 51388 |
| UniProt: | Q9Y221 |
| Reinheit: | Affinity purification |
| Sequenz: | MRPLTEEETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEKIMKLAANISGDKLVSLGTCFGKFTKTHKFRLHVTALDYLAPYAKYKVWIKPGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT |
| Target-Kategorie: | NIP7 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Stem Cells,Hematopoietic Progenitors. Shipping: Ice Bag |

