NIP7 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A4734
Article Name: NIP7 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A4734
Supplier Catalog Number: A4734
Alternative Catalog Number: ABB-A4734-100UL,ABB-A4734-20UL,ABB-A4734-1000UL,ABB-A4734-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: KD93, CGI-37, HSPC031, NIP7
Enables RNA binding activity. Predicted to be involved in ribosomal large subunit biogenesis. Located in cytosol, nucleolus, and nucleoplasm.
Clonality: Polyclonal
Molecular Weight: 20kDa
NCBI: 51388
UniProt: Q9Y221
Purity: Affinity purification
Sequence: MRPLTEEETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEKIMKLAANISGDKLVSLGTCFGKFTKTHKFRLHVTALDYLAPYAKYKVWIKPGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT
Target: NIP7
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Stem Cells,Hematopoietic Progenitors. Shipping: Ice Bag
Western blot analysis of various lysates using NIP7 Rabbit pAb (A4734) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.