ADAMTSL4 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: ADAMTSL4 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A4785
• Hersteller Artikelnummer: A4785
• Alternativnummer: ABB-A4785-20UL,ABB-A4785-100UL,ABB-A4785-1000UL,ABB-A4785-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human, Mouse, Rat
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 795-1074 of human ADAMTSL4 (NP_061905.2).
• Konjugation: Unconjugated
• Alternative Synonym: TSRC1, ECTOL2, ADAMTSL-4, ADAMTSL4

Produktbeschreibung

This gene is a member of ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs)-like gene family and encodes a protein with seven thrombospondin type 1 repeats. The thrombospondin type 1 repeat domain is found in many proteins with diver

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 117kDa
• NCBI: 54507
• UniProt: Q6UY14
• Reinheit: Affinity purification
• Sequenz: CSVRCGRGQRSRQVRCVGNNGDEVSEQECASGPPQPPSREACDMGPCTTAWFHSDWSSKCSAECGTGIQRRSVVCLGSGAALGPGQGEAGAGTGQSCPTGSRPPDMRACSLGPCERTWRWYTGPWGECSSECGSGTQRRDIICVSKLGTEFNVTSPSNCSHLPRPPALQPCQGQACQDRWFSTPWSPCSRSCQGGTQTREVQCLSTNQTLSTRCPPQLRPSRKRPCNSQPCSQRPDDQCKDSSPHCPLVVQARL
• Target-Kategorie: ADAMTSL4
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.