ADAMTSL4 Rabbit pAb, Unconjugated

Catalog Number: ABB-A4785
Article Name: ADAMTSL4 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A4785
Supplier Catalog Number: A4785
Alternative Catalog Number: ABB-A4785-20UL,ABB-A4785-100UL,ABB-A4785-1000UL,ABB-A4785-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 795-1074 of human ADAMTSL4 (NP_061905.2).
Conjugation: Unconjugated
Alternative Names: TSRC1, ECTOL2, ADAMTSL-4, ADAMTSL4
This gene is a member of ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs)-like gene family and encodes a protein with seven thrombospondin type 1 repeats. The thrombospondin type 1 repeat domain is found in many proteins with diver
Clonality: Polyclonal
Molecular Weight: 117kDa
NCBI: 54507
UniProt: Q6UY14
Purity: Affinity purification
Sequence: CSVRCGRGQRSRQVRCVGNNGDEVSEQECASGPPQPPSREACDMGPCTTAWFHSDWSSKCSAECGTGIQRRSVVCLGSGAALGPGQGEAGAGTGQSCPTGSRPPDMRACSLGPCERTWRWYTGPWGECSSECGSGTQRRDIICVSKLGTEFNVTSPSNCSHLPRPPALQPCQGQACQDRWFSTPWSPCSRSCQGGTQTREVQCLSTNQTLSTRCPPQLRPSRKRPCNSQPCSQRPDDQCKDSSPHCPLVVQARL
Target: ADAMTSL4
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.