CROT Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A4790
Artikelname: CROT Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A4790
Hersteller Artikelnummer: A4790
Alternativnummer: ABB-A4790-100UL,ABB-A4790-20UL,ABB-A4790-500UL,ABB-A4790-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IP, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: COT, CROT
This gene encodes a member of the carnitine/choline acetyltransferase family. The encoded protein converts 4,8-dimethylnonanoyl-CoA to its corresponding carnitine ester. This transesterification occurs in the peroxisome and is necessary for transport of medium- and long- chain acyl-CoA molecules out of the peroxisome to the cytosol and mitochondria. The protein thus plays a role in lipid metabolism and fatty acid beta-oxidation. Alternatively spliced transcript variants have been described.
Klonalität: Polyclonal
Molekulargewicht: 70kDa
NCBI: 54677
UniProt: Q9UKG9
Reinheit: Affinity purification
Sequenz: MENQLAKSTEERTFQYQDSLPSLPVPSLEESLKKYLESVKPFANQEEYKKTEEIVQKFQSGIGEKLHQKLLERAKGKRNWVFVVIIE
Target-Kategorie: CROT
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|IP,0.5µg-4µg antibody for 25µg-100µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Lipid Metabolism,Cardiovascular,Lipids,Fatty Acids. Shipping: Ice Bag
Western blot analysis of lysates from rat liver, using CROT Rabbit pAb (A4790) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.