CROT Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A4790
Article Name: CROT Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A4790
Supplier Catalog Number: A4790
Alternative Catalog Number: ABB-A4790-100UL,ABB-A4790-20UL,ABB-A4790-500UL,ABB-A4790-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IP, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: COT, CROT
This gene encodes a member of the carnitine/choline acetyltransferase family. The encoded protein converts 4,8-dimethylnonanoyl-CoA to its corresponding carnitine ester. This transesterification occurs in the peroxisome and is necessary for transport of medium- and long- chain acyl-CoA molecules out of the peroxisome to the cytosol and mitochondria. The protein thus plays a role in lipid metabolism and fatty acid beta-oxidation. Alternatively spliced transcript variants have been described.
Clonality: Polyclonal
Molecular Weight: 70kDa
NCBI: 54677
UniProt: Q9UKG9
Purity: Affinity purification
Sequence: MENQLAKSTEERTFQYQDSLPSLPVPSLEESLKKYLESVKPFANQEEYKKTEEIVQKFQSGIGEKLHQKLLERAKGKRNWVFVVIIE
Target: CROT
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|IP,0.5µg-4µg antibody for 25µg-100µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Lipid Metabolism,Cardiovascular,Lipids,Fatty Acids. Shipping: Ice Bag
Western blot analysis of lysates from rat liver, using CROT Rabbit pAb (A4790) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.