UGGT1 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: UGGT1 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A4866
• Hersteller Artikelnummer: A4866
• Alternativnummer: ABB-A4866-20UL,ABB-A4866-100UL,ABB-A4866-500UL,ABB-A4866-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: UGT1, HUGT1, UGCGL1, UGGT1

Produktbeschreibung

UDP-glucose:glycoprotein glucosyltransferase (UGT) is a soluble protein of the endoplasmic reticulum (ER) that selectively reglucosylates unfolded glycoproteins, thus providing quality control for protein transport out of the ER.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 177kDa
• NCBI: 56886
• UniProt: Q9NYU2
• Reinheit: Affinity purification
• Sequenz: PNNMIHQVPIKSLPQEWLWCETWCDDASKKRAKTIDLCNNPMTKEPKLEAAVRIVPEWQDYDQEIKQLQIRFQKEKETGALYKEKTKEPSREGPQKREEL
• Target-Kategorie: UGGT1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using UGGT1 Rabbit pAb (A4866) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.