UGGT1 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: UGGT1 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A4866
• Supplier Catalog Number: A4866
• Alternative Catalog Number: ABB-A4866-20UL,ABB-A4866-100UL,ABB-A4866-500UL,ABB-A4866-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: UGT1, HUGT1, UGCGL1, UGGT1

Product Description

UDP-glucose:glycoprotein glucosyltransferase (UGT) is a soluble protein of the endoplasmic reticulum (ER) that selectively reglucosylates unfolded glycoproteins, thus providing quality control for protein transport out of the ER.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 177kDa
• NCBI: 56886
• UniProt: Q9NYU2
• Purity: Affinity purification
• Sequence: PNNMIHQVPIKSLPQEWLWCETWCDDASKKRAKTIDLCNNPMTKEPKLEAAVRIVPEWQDYDQEIKQLQIRFQKEKETGALYKEKTKEPSREGPQKREEL
• Target: UGGT1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction. Shipping: Ice Bag

Images

Western blot analysis of various lysates using UGGT1 Rabbit pAb (A4866) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.