CAB39L Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A5017
- Bilder (1)
| Artikelname: | CAB39L Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A5017 |
| Hersteller Artikelnummer: | A5017 |
| Alternativnummer: | ABB-A5017-100UL,ABB-A5017-20UL,ABB-A5017-1000UL,ABB-A5017-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | MO2L, MO25-BETA, bA103J18.3, CAB39L |
| Predicted to enable protein serine/threonine kinase activator activity. Predicted to be involved in intracellular signal transduction. Predicted to be located in cytosol. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 39kDa |
| NCBI: | 81617 |
| UniProt: | Q9H9S4 |
| Reinheit: | Affinity purification |
| Sequenz: | MKKMPLFSKSHKNPAEIVKILKDNLAILEKQDKKTDKASEEVSKSLQAMKEILCGTNEKEPPTEAVAQLAQELYSSGLLVTLIADLQLIDFEGKKDVTQIFNNILRRQIGTRSPTVEYISAHPHILFMLLKGYEAPQIALRCGIMLRECIRHEPLAKIILFSNQFRDFFKYVELSTFDIASDAFATFKDLLTRHKVLVADFLEQNYDTIFEDYEKLLQSENYVTKRQSLKLLGELILDRHNFAIMTKYISKPENL |
| Target-Kategorie: | CAB39L |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Tumor biomarkers,Endocrine Metabolism,AMPK Signaling Pathway. Shipping: Ice Bag |

