CAB39L Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A5017
Artikelname: CAB39L Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A5017
Hersteller Artikelnummer: A5017
Alternativnummer: ABB-A5017-100UL,ABB-A5017-20UL,ABB-A5017-1000UL,ABB-A5017-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: MO2L, MO25-BETA, bA103J18.3, CAB39L
Predicted to enable protein serine/threonine kinase activator activity. Predicted to be involved in intracellular signal transduction. Predicted to be located in cytosol.
Klonalität: Polyclonal
Molekulargewicht: 39kDa
NCBI: 81617
UniProt: Q9H9S4
Reinheit: Affinity purification
Sequenz: MKKMPLFSKSHKNPAEIVKILKDNLAILEKQDKKTDKASEEVSKSLQAMKEILCGTNEKEPPTEAVAQLAQELYSSGLLVTLIADLQLIDFEGKKDVTQIFNNILRRQIGTRSPTVEYISAHPHILFMLLKGYEAPQIALRCGIMLRECIRHEPLAKIILFSNQFRDFFKYVELSTFDIASDAFATFKDLLTRHKVLVADFLEQNYDTIFEDYEKLLQSENYVTKRQSLKLLGELILDRHNFAIMTKYISKPENL
Target-Kategorie: CAB39L
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Tumor biomarkers,Endocrine Metabolism,AMPK Signaling Pathway. Shipping: Ice Bag
Western blot analysis of various lysates using CAB39L Rabbit pAb (A5017) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.