CAB39L Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: CAB39L Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A5017
• Supplier Catalog Number: A5017
• Alternative Catalog Number: ABB-A5017-100UL,ABB-A5017-20UL,ABB-A5017-1000UL,ABB-A5017-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: MO2L, MO25-BETA, bA103J18.3, CAB39L

Product Description

Predicted to enable protein serine/threonine kinase activator activity. Predicted to be involved in intracellular signal transduction. Predicted to be located in cytosol.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 39kDa
• NCBI: 81617
• UniProt: Q9H9S4
• Purity: Affinity purification
• Sequence: MKKMPLFSKSHKNPAEIVKILKDNLAILEKQDKKTDKASEEVSKSLQAMKEILCGTNEKEPPTEAVAQLAQELYSSGLLVTLIADLQLIDFEGKKDVTQIFNNILRRQIGTRSPTVEYISAHPHILFMLLKGYEAPQIALRCGIMLRECIRHEPLAKIILFSNQFRDFFKYVELSTFDIASDAFATFKDLLTRHKVLVADFLEQNYDTIFEDYEKLLQSENYVTKRQSLKLLGELILDRHNFAIMTKYISKPENL
• Target: CAB39L
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Tumor biomarkers,Endocrine Metabolism,AMPK Signaling Pathway. Shipping: Ice Bag

Images

Western blot analysis of various lysates using CAB39L Rabbit pAb (A5017) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.