CBR4 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: CBR4 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A5069
• Hersteller Artikelnummer: A5069
• Alternativnummer: ABB-A5069-20UL,ABB-A5069-100UL,ABB-A5069-1000UL,ABB-A5069-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: SDR45C1, CBR4

Produktbeschreibung

Enables several functions, including 3-oxoacyl-[acyl-carrier-protein] reductase (NADPH) activity, NADPH binding activity, and NADPH dehydrogenase (quinone) activity. Involved in fatty acid biosynthetic process, glycoside metabolic process, and protein tetramerization. Located in mitochondrial matrix. Part of oxidoreductase complex.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 25kDa
• NCBI: 84869
• UniProt: Q8N4T8
• Reinheit: Affinity purification
• Sequenz: MDKVCAVFGGSRGIGRAVAQLMARKGYRLAVIARNLEGAKAAAGDLGGDHLAFSCDVAKEHDVQNTFEELEKHLGRVNFLVNAAGINRDGLLVRTKTEDMVSQLHTNLLGSMLTCKAAMRTMIQQQGGSIVNVGSIVGLKGNSGQSVYSASKGGLVGFSRALAKEVARKKIRVNVVAPGFVHTDMTKDLKEEHLKKNIPLGRFGETIEVAHAVVFLLESPYITGHVLVVDGGLQLIL
• Target-Kategorie: CBR4
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Rat. ResearchArea: Cancer,Endocrine Metabolism. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using CBR4 Rabbit pAb (A5069) at 1:1000 dilution._Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25µg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 90s.