CBR4 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: CBR4 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A5069
• Supplier Catalog Number: A5069
• Alternative Catalog Number: ABB-A5069-20UL,ABB-A5069-100UL,ABB-A5069-1000UL,ABB-A5069-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: SDR45C1, CBR4

Product Description

Enables several functions, including 3-oxoacyl-[acyl-carrier-protein] reductase (NADPH) activity, NADPH binding activity, and NADPH dehydrogenase (quinone) activity. Involved in fatty acid biosynthetic process, glycoside metabolic process, and protein tetramerization. Located in mitochondrial matrix. Part of oxidoreductase complex.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 25kDa
• NCBI: 84869
• UniProt: Q8N4T8
• Purity: Affinity purification
• Sequence: MDKVCAVFGGSRGIGRAVAQLMARKGYRLAVIARNLEGAKAAAGDLGGDHLAFSCDVAKEHDVQNTFEELEKHLGRVNFLVNAAGINRDGLLVRTKTEDMVSQLHTNLLGSMLTCKAAMRTMIQQQGGSIVNVGSIVGLKGNSGQSVYSASKGGLVGFSRALAKEVARKKIRVNVVAPGFVHTDMTKDLKEEHLKKNIPLGRFGETIEVAHAVVFLLESPYITGHVLVVDGGLQLIL
• Target: CBR4
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Rat. ResearchArea: Cancer,Endocrine Metabolism. Shipping: Ice Bag

Images

Western blot analysis of various lysates using CBR4 Rabbit pAb (A5069) at 1:1000 dilution._Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25µg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 90s.