TSPAN33 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: TSPAN33 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A5222
• Hersteller Artikelnummer: A5222
• Alternativnummer: ABB-A5222-20UL,ABB-A5222-100UL,ABB-A5222-1000UL,ABB-A5222-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: PEN, PEN., TSPAN-33, TSPAN33

Produktbeschreibung

Enables enzyme binding activity. Involved in pore complex assembly, protein localization to plasma membrane, and protein maturation. Located in plasma membrane. Part of pore complex.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 32kDa
• NCBI: 340348
• UniProt: Q86UF1
• Reinheit: Affinity purification
• Sequenz: NTMCGQGMQAFDYLEASKVIYTNGCIDKLVNWIHSNLFLLGGVALGLAIPQLVGILLSQILVNQIKDQIKLQLYNQQHRADPWY
• Target-Kategorie: TSPAN33
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:200 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology & Developmental Biology. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using TSPAN33 Rabbit pAb (A5222) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.