TSPAN33 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A5222
Artikelname: TSPAN33 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A5222
Hersteller Artikelnummer: A5222
Alternativnummer: ABB-A5222-20UL,ABB-A5222-100UL,ABB-A5222-1000UL,ABB-A5222-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: PEN, PEN., TSPAN-33, TSPAN33
Enables enzyme binding activity. Involved in pore complex assembly, protein localization to plasma membrane, and protein maturation. Located in plasma membrane. Part of pore complex.
Klonalität: Polyclonal
Molekulargewicht: 32kDa
NCBI: 340348
UniProt: Q86UF1
Reinheit: Affinity purification
Sequenz: NTMCGQGMQAFDYLEASKVIYTNGCIDKLVNWIHSNLFLLGGVALGLAIPQLVGILLSQILVNQIKDQIKLQLYNQQHRADPWY
Target-Kategorie: TSPAN33
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:200 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology & Developmental Biology. Shipping: Ice Bag
Western blot analysis of various lysates using TSPAN33 Rabbit pAb (A5222) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.