TSPAN33 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: TSPAN33 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A5222
• Supplier Catalog Number: A5222
• Alternative Catalog Number: ABB-A5222-20UL,ABB-A5222-100UL,ABB-A5222-1000UL,ABB-A5222-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: PEN, PEN., TSPAN-33, TSPAN33

Product Description

Enables enzyme binding activity. Involved in pore complex assembly, protein localization to plasma membrane, and protein maturation. Located in plasma membrane. Part of pore complex.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 32kDa
• NCBI: 340348
• UniProt: Q86UF1
• Purity: Affinity purification
• Sequence: NTMCGQGMQAFDYLEASKVIYTNGCIDKLVNWIHSNLFLLGGVALGLAIPQLVGILLSQILVNQIKDQIKLQLYNQQHRADPWY
• Target: TSPAN33
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:200 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology & Developmental Biology. Shipping: Ice Bag

Images

Western blot analysis of various lysates using TSPAN33 Rabbit pAb (A5222) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.