CISD2 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: CISD2 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A5231
• Hersteller Artikelnummer: A5231
• Alternativnummer: ABB-A5231-100UL,ABB-A5231-20UL,ABB-A5231-500UL,ABB-A5231-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: ERIS, WFS2, ZCD2, NAF-1, Miner1, CISD2

Produktbeschreibung

The protein encoded by this gene is a zinc finger protein that localizes to the endoplasmic reticulum. The encoded protein binds an iron/sulfur cluster and may be involved in calcium homeostasis. Defects in this gene are a cause of Wolfram syndrome 2.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 15kDa
• NCBI: 493856
• UniProt: Q8N5K1
• Reinheit: Affinity purification
• Sequenz: PKKKQQKDSLINLKIQKENPKVVNEINIEDLCLTKAAYCRCWRSKTFPACDGSHNKHNELTGDNVGPLILKKKEV
• Target-Kategorie: CISD2
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|IHC-P,1:100 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Neuroscience,Calcium Signaling. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using CISD2 Rabbit pAb (A5231) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.