CISD2 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: CISD2 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A5231
• Supplier Catalog Number: A5231
• Alternative Catalog Number: ABB-A5231-100UL,ABB-A5231-20UL,ABB-A5231-500UL,ABB-A5231-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IHC-P, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: ERIS, WFS2, ZCD2, NAF-1, Miner1, CISD2

Product Description

The protein encoded by this gene is a zinc finger protein that localizes to the endoplasmic reticulum. The encoded protein binds an iron/sulfur cluster and may be involved in calcium homeostasis. Defects in this gene are a cause of Wolfram syndrome 2.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 15kDa
• NCBI: 493856
• UniProt: Q8N5K1
• Purity: Affinity purification
• Sequence: PKKKQQKDSLINLKIQKENPKVVNEINIEDLCLTKAAYCRCWRSKTFPACDGSHNKHNELTGDNVGPLILKKKEV
• Target: CISD2
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|IHC-P,1:100 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Neuroscience,Calcium Signaling. Shipping: Ice Bag

Images

Western blot analysis of various lysates using CISD2 Rabbit pAb (A5231) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.