CISD2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A5231
Article Name: CISD2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A5231
Supplier Catalog Number: A5231
Alternative Catalog Number: ABB-A5231-100UL,ABB-A5231-20UL,ABB-A5231-500UL,ABB-A5231-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: ERIS, WFS2, ZCD2, NAF-1, Miner1, CISD2
The protein encoded by this gene is a zinc finger protein that localizes to the endoplasmic reticulum. The encoded protein binds an iron/sulfur cluster and may be involved in calcium homeostasis. Defects in this gene are a cause of Wolfram syndrome 2.
Clonality: Polyclonal
Molecular Weight: 15kDa
NCBI: 493856
UniProt: Q8N5K1
Purity: Affinity purification
Sequence: PKKKQQKDSLINLKIQKENPKVVNEINIEDLCLTKAAYCRCWRSKTFPACDGSHNKHNELTGDNVGPLILKKKEV
Target: CISD2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|IHC-P,1:100 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Neuroscience,Calcium Signaling. Shipping: Ice Bag
Western blot analysis of various lysates using CISD2 Rabbit pAb (A5231) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.