MT-ND1 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: MT-ND1 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A5250
• Hersteller Artikelnummer: A5250
• Alternativnummer: ABB-A5250-100UL,ABB-A5250-20UL,ABB-A5250-500UL,ABB-A5250-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Mouse
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: TrnI, MT-ND1

Produktbeschreibung

Predicted to enable triplet codon-amino acid adaptor activity. Predicted to act upstream of or within translation. Predicted to be located in mitochondrion. Orthologous to human MT-TI (mitochondrially encoded tRNA-Ile (AUU/C)).

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 36kDa
• NCBI: 17716
• UniProt: P03888
• Reinheit: Affinity purification
• Sequenz: MFFINILTLLVPILIAMAFLTLVERKILGYMQLRKGPNIVGPYGILQPFADAMKLFMKEPMRPLTTSMSLFIIAPTLSLTLALSLWVPLPMPHPLINLNL
• Target-Kategorie: MT-ND1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using MT-ND1 Rabbit pAb (A5250) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.