MT-ND1 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: MT-ND1 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A5250
• Supplier Catalog Number: A5250
• Alternative Catalog Number: ABB-A5250-100UL,ABB-A5250-20UL,ABB-A5250-500UL,ABB-A5250-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Mouse
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: TrnI, MT-ND1

Product Description

Predicted to enable triplet codon-amino acid adaptor activity. Predicted to act upstream of or within translation. Predicted to be located in mitochondrion. Orthologous to human MT-TI (mitochondrially encoded tRNA-Ile (AUU/C)).

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 36kDa
• NCBI: 17716
• UniProt: P03888
• Purity: Affinity purification
• Sequence: MFFINILTLLVPILIAMAFLTLVERKILGYMQLRKGPNIVGPYGILQPFADAMKLFMKEPMRPLTTSMSLFIIAPTLSLTLALSLWVPLPMPHPLINLNL
• Target: MT-ND1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse. Shipping: Ice Bag

Images

Western blot analysis of various lysates using MT-ND1 Rabbit pAb (A5250) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.